rat nav1 9 rabbit asc (Alomone Labs)
Alomone Labs is a verified supplier 
Alomone Labs manufactures this product 
94
Structured Review
Alomone Labs
rat nav1 9 rabbit asc
Rat Nav1 9 Rabbit Asc, supplied by Alomone Labs, used in various techniques. Bioz Stars score: 94/100, based on 22 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/rat+nav1+9+rabbit+asc/Anti-SCN11A+(Nav1%2E9)+Antibody/pm38099210-153-148-151
Average 94 stars, based on 22 article reviews
Rat Nav1 9 Rabbit Asc, supplied by Alomone Labs, used in various techniques. Bioz Stars score: 94/100, based on 22 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/rat+nav1+9+rabbit+asc/Anti-SCN11A+(Nav1%2E9)+Antibody/pm38099210-153-148-151
Average 94 stars, based on 22 article reviews
rat nav1 9 rabbit asc - by Bioz Stars,
2026-09
94/100 stars
Images
Related Articles
Immunohistochemistry:Article Title: Unveiling the mechanisms of neuropathic pain suppression: perineural resiniferatoxin targets Trpv1 and beyond. Article Snippet: Similarly, incubation of rabbit anti-Trpv1 antibody pre-absorbed with Trpv1 control peptide (Cat No. BML-KI359, ENZO TABLE 1 Primary antibodies used, source and dilution. .. Antibody Immunogen Host Catalogue/source RRIDs Dilution IHC/WB Trpv1 YTGSLKPEDAEVFKDSMVPGEK Guinea Pig GP14100/ Neuromics, MN, United States AB_1624142 1:2000/− Trpv1 Synthetic peptide corresponding to aa 824–838 (C-terminus) of rat Trpv1 Rabbit BML SA-564/ ENZO Life Sciences, Postfach CH-4415 Lausen Switzerland −/1:500 IB4 Purified Griffonia simplicifolia lectin I whole molecule Goat AS2104/Vector Laboratories, Peterborough, United Kingdom AB_2314660 1:1000/− Kv1.1 GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIR TGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416–495 of mouse KV1.1 Rabbit APC-009/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040144 1:500/ 1:500 Kir4.1 Peptide (C)KLEE SLREQ AEKEG SALSV R, corresponding to amino acid residues 356–375 of rat Kir4.1 Rabbit APC-035/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040120 1:1000/ 1:500 Kv4.3 Peptide(C)NEALELTGTPEEEHMGK, corresponding to amino acid residues 451–468 of human KV4.3 Rabbit APC-017/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040178 1:1000/ 1:500 Nav1.9 Peptide CNGDLSSLDVAKVKVHND, corresponding to amino acid residues 1748–1765 of Purification:Article Title: Unveiling the mechanisms of neuropathic pain suppression: perineural resiniferatoxin targets Trpv1 and beyond. Article Snippet: Similarly, incubation of rabbit anti-Trpv1 antibody pre-absorbed with Trpv1 control peptide (Cat No. BML-KI359, ENZO TABLE 1 Primary antibodies used, source and dilution. .. Antibody Immunogen Host Catalogue/source RRIDs Dilution IHC/WB Trpv1 YTGSLKPEDAEVFKDSMVPGEK Guinea Pig GP14100/ Neuromics, MN, United States AB_1624142 1:2000/− Trpv1 Synthetic peptide corresponding to aa 824–838 (C-terminus) of rat Trpv1 Rabbit BML SA-564/ ENZO Life Sciences, Postfach CH-4415 Lausen Switzerland −/1:500 IB4 Purified Griffonia simplicifolia lectin I whole molecule Goat AS2104/Vector Laboratories, Peterborough, United Kingdom AB_2314660 1:1000/− Kv1.1 GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIR TGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416–495 of mouse KV1.1 Rabbit APC-009/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040144 1:500/ 1:500 Kir4.1 Peptide (C)KLEE SLREQ AEKEG SALSV R, corresponding to amino acid residues 356–375 of rat Kir4.1 Rabbit APC-035/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040120 1:1000/ 1:500 Kv4.3 Peptide(C)NEALELTGTPEEEHMGK, corresponding to amino acid residues 451–468 of human KV4.3 Rabbit APC-017/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040178 1:1000/ 1:500 Nav1.9 Peptide CNGDLSSLDVAKVKVHND, corresponding to amino acid residues 1748–1765 of Sequencing:Article Title: Unveiling the mechanisms of neuropathic pain suppression: perineural resiniferatoxin targets Trpv1 and beyond. Article Snippet: Similarly, incubation of rabbit anti-Trpv1 antibody pre-absorbed with Trpv1 control peptide (Cat No. BML-KI359, ENZO TABLE 1 Primary antibodies used, source and dilution. .. Antibody Immunogen Host Catalogue/source RRIDs Dilution IHC/WB Trpv1 YTGSLKPEDAEVFKDSMVPGEK Guinea Pig GP14100/ Neuromics, MN, United States AB_1624142 1:2000/− Trpv1 Synthetic peptide corresponding to aa 824–838 (C-terminus) of rat Trpv1 Rabbit BML SA-564/ ENZO Life Sciences, Postfach CH-4415 Lausen Switzerland −/1:500 IB4 Purified Griffonia simplicifolia lectin I whole molecule Goat AS2104/Vector Laboratories, Peterborough, United Kingdom AB_2314660 1:1000/− Kv1.1 GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIR TGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416–495 of mouse KV1.1 Rabbit APC-009/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040144 1:500/ 1:500 Kir4.1 Peptide (C)KLEE SLREQ AEKEG SALSV R, corresponding to amino acid residues 356–375 of rat Kir4.1 Rabbit APC-035/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040120 1:1000/ 1:500 Kv4.3 Peptide(C)NEALELTGTPEEEHMGK, corresponding to amino acid residues 451–468 of human KV4.3 Rabbit APC-017/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040178 1:1000/ 1:500 Nav1.9 Peptide CNGDLSSLDVAKVKVHND, corresponding to amino acid residues 1748–1765 of Concentration Assay:Article Title: Unveiling the mechanisms of neuropathic pain suppression: perineural resiniferatoxin targets Trpv1 and beyond. Article Snippet: Similarly, incubation of rabbit anti-Trpv1 antibody pre-absorbed with Trpv1 control peptide (Cat No. BML-KI359, ENZO TABLE 1 Primary antibodies used, source and dilution. .. Antibody Immunogen Host Catalogue/source RRIDs Dilution IHC/WB Trpv1 YTGSLKPEDAEVFKDSMVPGEK Guinea Pig GP14100/ Neuromics, MN, United States AB_1624142 1:2000/− Trpv1 Synthetic peptide corresponding to aa 824–838 (C-terminus) of rat Trpv1 Rabbit BML SA-564/ ENZO Life Sciences, Postfach CH-4415 Lausen Switzerland −/1:500 IB4 Purified Griffonia simplicifolia lectin I whole molecule Goat AS2104/Vector Laboratories, Peterborough, United Kingdom AB_2314660 1:1000/− Kv1.1 GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIR TGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416–495 of mouse KV1.1 Rabbit APC-009/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040144 1:500/ 1:500 Kir4.1 Peptide (C)KLEE SLREQ AEKEG SALSV R, corresponding to amino acid residues 356–375 of rat Kir4.1 Rabbit APC-035/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040120 1:1000/ 1:500 Kv4.3 Peptide(C)NEALELTGTPEEEHMGK, corresponding to amino acid residues 451–468 of human KV4.3 Rabbit APC-017/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040178 1:1000/ 1:500 Nav1.9 Peptide CNGDLSSLDVAKVKVHND, corresponding to amino acid residues 1748–1765 of Incubation:Article Title: Unveiling the mechanisms of neuropathic pain suppression: perineural resiniferatoxin targets Trpv1 and beyond. Article Snippet: Similarly, incubation of rabbit anti-Trpv1 antibody pre-absorbed with Trpv1 control peptide (Cat No. BML-KI359, ENZO TABLE 1 Primary antibodies used, source and dilution. .. Antibody Immunogen Host Catalogue/source RRIDs Dilution IHC/WB Trpv1 YTGSLKPEDAEVFKDSMVPGEK Guinea Pig GP14100/ Neuromics, MN, United States AB_1624142 1:2000/− Trpv1 Synthetic peptide corresponding to aa 824–838 (C-terminus) of rat Trpv1 Rabbit BML SA-564/ ENZO Life Sciences, Postfach CH-4415 Lausen Switzerland −/1:500 IB4 Purified Griffonia simplicifolia lectin I whole molecule Goat AS2104/Vector Laboratories, Peterborough, United Kingdom AB_2314660 1:1000/− Kv1.1 GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIR TGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416–495 of mouse KV1.1 Rabbit APC-009/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040144 1:500/ 1:500 Kir4.1 Peptide (C)KLEE SLREQ AEKEG SALSV R, corresponding to amino acid residues 356–375 of rat Kir4.1 Rabbit APC-035/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040120 1:1000/ 1:500 Kv4.3 Peptide(C)NEALELTGTPEEEHMGK, corresponding to amino acid residues 451–468 of human KV4.3 Rabbit APC-017/Alomone Labs, Jerusalem BioPark (JBP) Jerusalem 9,104,201 Israel AB_2040178 1:1000/ 1:500 Nav1.9 Peptide CNGDLSSLDVAKVKVHND, corresponding to amino acid residues 1748–1765 of |